| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM22038 |
|---|
| Substrate/Competitor | BDBM22032 |
|---|
| Meas. Tech. | Radioligand Binding Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 277.15±n/a K |
|---|
| Ki | 0.37±0.13 nM |
|---|
| Citation |  Taliani, S; Simorini, F; Sergianni, V; La Motta, C; Da Settimo, F; Cosimelli, B; Abignente, E; Greco, G; Novellino, E; Rossi, L; Gremigni, V; Spinetti, F; Chelli, B; Martini, C New fluorescent 2-phenylindolglyoxylamide derivatives as probes targeting the peripheral-type benzodiazepine receptor: design, synthesis, and biological evaluation. J Med Chem50:404-7 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM22038 |
|---|
| BDBM22032 |
|---|
| Name | BDBM22038 |
|---|
| Synonyms: | 2-[2-(4-fluorophenyl)-1H-indol-3-yl]-N,N-dihexyl-2-oxoacetamide | CHEMBL53430 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H35FN2O2 |
|---|
| Mol. Mass. | 450.5881 |
|---|
| SMILES | CCCCCCN(CCCCCC)C(=O)C(=O)c1c([nH]c2ccccc12)-c1ccc(F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
