| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Isocitrate dehydrogenase [NADP] cytoplasmic [R132H] |
|---|
| Ligand | BDBM375166 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | IDH1-R132H and IDH1-R132C Enzymatic Assay |
|---|
| IC50 | <10±n/a nM |
|---|
| Citation |  Lin, J; Ericsson, A; Campbell, A; Gustafson, G; Wang, Z; Diebold, RB; Ashwell, S; Lancia, Jr., DR; Caravella, JA; Lu, W Pyridinyl quinolinone derivatives as mutant-isocitrate dehydrogenase inhibitors US Patent US10253015 Publication Date 4/9/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Isocitrate dehydrogenase [NADP] cytoplasmic [R132H] |
|---|
| Name: | Isocitrate dehydrogenase [NADP] cytoplasmic [R132H] |
|---|
| Synonyms: | Cytosolic NADP-isocitrate dehydrogenase (IDH1)(R132H) | IDH1 | IDH1 R132H | IDH1(R132H) | IDHC_HUMAN | Isocitrate dehydrogenase (IDH1)(R132H) | Isocitrate dehydrogenase 1 mutant (R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (IDH)(R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (IDH1)(R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (R132H) | PICD |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 46641.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human IDH1 R132H (SEQ ID No. 2 in patent). First three are removed. Google patent parsed wrong. |
|---|
| Residue: | 414 |
|---|
| Sequence: | MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGHHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE
AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE
EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
|
|
|
|---|
| BDBM375166 |
|---|
| n/a |
|---|
| Name | BDBM375166 |
|---|
| Synonyms: | 6-{[(1S)-1-(6-chloro-7- | US10253015, Compound I-26 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H17ClN4O3 |
|---|
| Mol. Mass. | 384.816 |
|---|
| SMILES | COc1cc2[nH]c(=O)c(cc2cc1Cl)[C@H](C)Nc1ccc(C#N)c(OC)n1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
