Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLck
LigandBDBM25191
Substrate/CompetitorBiotinylated Peptide Substrate
Meas. Tech.Time Resolved Fluorescence Resonance Energy Transfer Assay
pH7.4±n/a
Temperature295.15±n/a K
Ki 20±n/a nM
IC50 59±n/a nM
Citation Angell RMBamborough PCleasby ACockerill SGJones KLMooney CJSomers DOWalker AL Biphenyl amide p38 kinase inhibitors 1: Discovery and binding mode. Bioorg Med Chem Lett 18:318-23 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Lck
Name:Tyrosine-protein kinase LCK
Synonyms:LSK | Lymphocyte cell-specific protein-tyrosine kinase | Proto-oncogene tyrosine-protein kinase LCK | p56-LCK
Type:PROTEIN
Mol. Mass.:57927.84
Organism:Mus musculus
Description:ChEMBL_806408
Residue:509
Sequence:
MGCVCSSNPEDDWMENIDVCENCHYPIVPLDSKISLPIRNGSEVRDPLVTYEGSLPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHDLVRHYTNASDGLCTKLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHPRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLNVNKLLDMAAQIAEGMAFIEEQNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYHLMMLCWKER
PEDRPTFDYLRSVLDDFFTATEGQYQPQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25191
Biotinylated Peptide Substrate
Name:Biotinylated Peptide Substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:1622.70
Organism:n/a
Description:n/a
Residue:13
Sequence:
Biotin-EEEEYFELV