Reaction Details |
| Report a problem with these data |
Target | Aldo-keto reductase family 1 member C1 [L54V] |
---|
Ligand | BDBM26269 |
---|
Substrate/Competitor | BDBM26270 |
---|
Meas. Tech. | Assay of Enzyme Activity |
---|
pH | 7.4±n/a |
---|
Temperature | 298.15±n/a K |
---|
Ki | 85±7.6 nM |
---|
Citation | Dhagat, U; Endo, S; Sumii, R; Hara, A; El-Kabbani, O Selectivity determinants of inhibitor binding to human 20alpha-hydroxysteroid dehydrogenase: crystal structure of the enzyme in ternary complex with coenzyme and the potent inhibitor 3,5-dichlorosalicylic acid. J Med Chem51:4844-8 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Aldo-keto reductase family 1 member C1 [L54V] |
---|
Name: | Aldo-keto reductase family 1 member C1 [L54V] |
Synonyms: | 20-alpha-Hydroxysteroid Dehydrogenase (AKR1C1) Mutant (L54V) | AK1C1_HUMAN | AKR1C1 | DDH | DDH1 |
Type: | Enzyme |
Mol. Mass.: | 36779.94 |
Organism: | Homo sapiens (Human) |
Description: | Q04828[L54V] |
Residue: | 323 |
Sequence: | MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHVYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV
SVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN
RNVRYLTLDIFAGPPNYPFSDEY
|
|
|
BDBM26269 |
---|
BDBM26270 |
---|
Name | BDBM26269 |
Synonyms: | 3,5-dichloro-2-hydroxybenzoic acid | 3,5-dichlorosalicylic acid | CHEMBL449129 |
Type | Small organic molecule |
Emp. Form. | C7H4Cl2O3 |
Mol. Mass. | 207.011 |
SMILES | OC(=O)c1cc(Cl)cc(Cl)c1O |
Structure |
|