Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Protease
LigandBDBM719
Substrate/CompetitorHIV-1 Protease substrate
Meas. Tech.Protease Inhibition Assay
pH6±n/a
Temperature310.15±n/a K
Ki 0.088±n/a nM
Citation Mimoto TKato RTakaku HNojima STerashima KMisawa SFukazawa TUeno TSato HShintani MKiso YHayashi H Structure-activity relationship of small-sized HIV protease inhibitors containing allophenylnorstatine. J Med Chem 42:1789-802 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
HIV-1 Protease
Name:HIV-1 Protease
Synonyms:n/a
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Protease chain A
Synonyms:HIV-1 Protease (NY5-type sequence)
Type:Enzyme Subunit
Mol. Mass.:10822.21
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Protease chain A
Synonyms:HIV-1 Protease (NY5-type sequence)
Type:Enzyme Subunit
Mol. Mass.:10822.21
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM719
HIV-1 Protease substrate
Name:HIV-1 Protease substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:2535.82
Organism:Synthetic peptide
Description:n/a
Residue:22
Sequence:
H-Ser-Gln-Asn-Tyr-Pro-Ile-Val-OH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: