| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Genome polyprotein [1393-1439,E1407V]/[1476-1660,R1508K,A1566M] |
|---|
| Ligand | BDBM33251 |
|---|
| Substrate/Competitor | BDBM33248 |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 310.15±n/a K |
|---|
| IC50 | 2000±n/a nM |
|---|
| Comments | Hill slope=2.4 |
|---|
| Citation |  Bodenreider, C; Beer, D; Keller, TH; Sonntag, S; Wen, D; Yap, L; Yau, YH; Shochat, SG; Huang, D; Zhou, T; Caflisch, A; Su, XC; Ozawa, K; Otting, G; Vasudevan, SG; Lescar, J; Lim, SP A fluorescence quenching assay to discriminate between specific and nonspecific inhibitors of dengue virus protease. Anal Biochem395:195-204 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Genome polyprotein [1393-1439,E1407V]/[1476-1660,R1508K,A1566M] |
|---|
| Name: | Genome polyprotein [1393-1439,E1407V]/[1476-1660,R1508K,A1566M] |
|---|
| Synonyms: | Dengue Virus 1 (DENV1) NS2B-NS3 Protease |
|---|
| Type: | Cofactor/Enzyme |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Genome polyprotein [1393-1439,E1407V] |
|---|
| Synonyms: | Flavivirus non-structural protein NS2B | NS2B | POLG_DEN1S |
|---|
| Type: | Cofactor Domain |
|---|
| Mol. Mass.: | 5202.48 |
|---|
| Organism: | Dengue virus 1(Hawaii) |
|---|
| Description: | P33478[1393-1439,E1407V] |
|---|
| Residue: | 47 |
|---|
| Sequence: | adlslek aaevswevea ehsgashnil vevqddgtmk ikdeerddtl
|
|
|
|---|
| Component 2 |
| Name: | Genome polyprotein [1476-1660,R1508K,A1566M] |
|---|
| Synonyms: | Flavivirus NS3 serine protease | NS3 | POLG_DEN1W |
|---|
| Type: | Catalytic Domain |
|---|
| Mol. Mass.: | 19899.28 |
|---|
| Organism: | Dengue virus 1(Hawaii) |
|---|
| Description: | P17763[1476-1660,R1508K,A1566M] |
|---|
| Residue: | 185 |
|---|
| Sequence: | SGVLWDTPSPPEVERAVLDDGIYRILQRGLLGKSQVGVGVFQEGVFHTMWHVTRGAVLMY
QGKRLEPSWASVKKDLISYGGGWRFQGSWNMGEEVQVIAVEPGKNPKNVQTAPGTFKTPE
GEVGAIALDFKPGTSGSPIVNREGKIVGLYGNGVVTTSGTYVSAIAQAKASQEGPLPEIE
DEVFR
|
|
|
|---|
| BDBM33251 |
|---|
| BDBM33248 |
|---|
| Name | BDBM33251 |
|---|
| Synonyms: | phthalazine-based compound, 2 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H24N6 |
|---|
| Mol. Mass. | 456.5411 |
|---|
| SMILES | C1CN=C(N1)c1ccc(Nc2nnc(Nc3ccc(cc3)-c3ccccc3)c3ccccc23)cc1 |c:2| |
|---|
| Structure | 
|
|---|
Search and Browse
