| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Genome polyprotein [1394-1440]/[1476-1660] |
|---|
| Ligand | BDBM33259 |
|---|
| Substrate/Competitor | BDBM33248 |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| IC50 | 1400±n/a nM |
|---|
| Citation |  Bodenreider, C; Beer, D; Keller, TH; Sonntag, S; Wen, D; Yap, L; Yau, YH; Shochat, SG; Huang, D; Zhou, T; Caflisch, A; Su, XC; Ozawa, K; Otting, G; Vasudevan, SG; Lescar, J; Lim, SP A fluorescence quenching assay to discriminate between specific and nonspecific inhibitors of dengue virus protease. Anal Biochem395:195-204 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Genome polyprotein [1394-1440]/[1476-1660] |
|---|
| Name: | Genome polyprotein [1394-1440]/[1476-1660] |
|---|
| Synonyms: | Dengue Virus 4 (DENV4) NS2B-NS3 Protease |
|---|
| Type: | Cofactor/Enzyme |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Genome polyprotein [1394-1440] |
|---|
| Synonyms: | Flavivirus non-structural protein NS2B | NS2B | POLG_DEN4P |
|---|
| Type: | Cofactor Domain |
|---|
| Mol. Mass.: | 5233.59 |
|---|
| Organism: | Dengue virus 4 (H241) |
|---|
| Description: | Q58HT7[1394-1440] |
|---|
| Residue: | 47 |
|---|
| Sequence: | dlsleka anvqwdemad itgsspiiev kqdedgsfsi rdieetnmit
|
|
|
|---|
| Component 2 |
| Name: | Genome polyprotein [1476-1660] |
|---|
| Synonyms: | Flavivirus NS3 serine protease | NS3 | POLG_DEN4P |
|---|
| Type: | Catalytic Domain |
|---|
| Mol. Mass.: | 20242.25 |
|---|
| Organism: | Dengue virus 4 (H241) |
|---|
| Description: | Q58HT7[1476-1660] |
|---|
| Residue: | 185 |
|---|
| Sequence: | GALWDVPSPAAAQKATLTEGVYRIMQRGLFGKTQVGVGIHMEGVFHTMWHVTRGSVICHE
TGRLEPSWADVRNDMISYGGGWRLGDKWDKEEDVQVLAIEPGKNPKHVQTKPGLFKTLTG
EIGAVTLDFKPGTSGSPIINRKGKVIGLYGNGVVTKSGDYVSAITQAERTGEPDYEVDED
IFRKK
|
|
|
|---|
| BDBM33259 |
|---|
| BDBM33248 |
|---|
| Name | BDBM33259 |
|---|
| Synonyms: | Bz-NKRR-H | Bz-Nle-Lys-Arg-Arg-H | CHEMBL256877 |
|---|
| Type | n/a |
|---|
| Emp. Form. | C31H53N11O5 |
|---|
| Mol. Mass. | 659.8232 |
|---|
| SMILES | [#6]-[#6]-[#6]-[#6]-[#6@H](-[#7]-[#6](=O)-c1ccccc1)-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]-[#6]-[#7])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](/[#7])-[#7])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](/[#7])-[#7])-[#6]=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
