| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Oxysterols receptor LXR-alpha [197-447] |
|---|
| Ligand | BDBM35103 |
|---|
| Substrate/Competitor | BDBM19993 |
|---|
| Meas. Tech. | LXR Binding Assay and hLXR Reporter Assay |
|---|
| IC50 | 74±n/a nM |
|---|
| Citation |  Bernotas, RC; Singhaus, RR; Kaufman, DH; Ullrich, J; Fletcher, H; Quinet, E; Nambi, P; Unwalla, R; Wilhelmsson, A; Goos-Nilsson, A; Farnegardh, M; Wrobel, J Biarylether amide quinolines as liver X receptor agonists. Bioorg Med Chem17:1663-70 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Oxysterols receptor LXR-alpha [197-447] |
|---|
| Name: | Oxysterols receptor LXR-alpha [197-447] |
|---|
| Synonyms: | LXRA | Liver X Receptor alpha (LXR-alpha) | NR1H3 | NR1H3_HUMAN | Nuclear orphan receptor LXR-alpha | Nuclear receptor subfamily 1 group H member 3 | Oxysterols receptor LXR-alpha |
|---|
| Type: | Receptor |
|---|
| Mol. Mass.: | 28986.41 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | LXR alpha ligand binding domain (amino acid residues 197-447) with an N-terminal biotinylation tag expressed in E.coli, was used for the binding assays. |
|---|
| Residue: | 251 |
|---|
| Sequence: | SSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREARQQRFAH
FTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFL
KDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQL
QVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLP
PLLSEIWDVHE
|
|
|
|---|
| BDBM35103 |
|---|
| BDBM19993 |
|---|
| Name | BDBM35103 |
|---|
| Synonyms: | biarylether amide quinoline, 4c |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H27F3N2O2 |
|---|
| Mol. Mass. | 540.5749 |
|---|
| SMILES | CC(C)NC(=O)c1cccc(Oc2cccc(c2)-c2c(Cc3ccccc3)cnc3c(cccc23)C(F)(F)F)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
