Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Reverse Transcriptase
LigandBDBM1747
Substrate/CompetitorRNA:DNA template:primer
Meas. Tech.HIV-1 RT Assay
pH8±n/a
IC50 7100±n/a nM
CommentsHIV-1 RT inhibitor 2-nitrophenyl phenyl sulfone (NPPS) shows IC50 value of 16,000 nM in the same enzyme assay.
Citation Chan JHHong JSHunter RNOrr GFCowan JRSherman DBSparks SMReitter BEAndrews CWHazen RJSt Clair MBoone LRFerris RGCreech KLRoberts GBShort SAWeaver KOtt RJRen JHopkins AStuart DIStammers DK 2-Amino-6-arylsulfonylbenzonitriles as non-nucleoside reverse transcriptase inhibitors of HIV-1. J Med Chem 44:1866-82 (2001) [PubMed]
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
HIV-1 Reverse Transcriptase
Name:HIV-1 Reverse Transcriptase
Synonyms:EC: 2.7.7.49
Type:Protein Complex
Mol. Mass.:115684
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Reverse Transcriptase Chain A
Synonyms:n/a
Type:Enzyme Subunit
Mol. Mass.:64383.27
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:559
Sequence:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAEL
ELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAH
TNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPP
LVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQA
IYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKG
IGGNEQVDKLVSAGIRKVL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Reverse Transcriptase Chain B
Synonyms:n/a
Type:Enzyme Subunit
Mol. Mass.:51337.13
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:440
Sequence:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM1747
RNA:DNA template:primer
Name:RNA:DNA template:primer
Synonyms:n/a
Type:RNA-DNA duplex
Mol. Mass.:358.43
Organism:n/a
Description:The incorporation of Cy5-dUTP onto a Europium(Eu) labeled primer:template.
Residue:3
Sequence:
n/a