Reaction Details |
| Report a problem with these data |
Target | cAMP-dependent protein kinase catalytic subunit alpha |
---|
Ligand | BDBM2579 |
---|
Substrate/Competitor | histone (type Vs) |
---|
Meas. Tech. | PKA assay |
---|
pH | 8.5±n/a |
---|
Temperature | 310.15±n/a K |
---|
IC50 | 121±18 nM |
---|
Citation | Bit, RA; Davis, PD; Elliott, LH; Harris, W; Hill, CH; Keech, E; Kumar, H; Lawton, G; Maw, A; Nixon, JS Inhibitors of protein kinase C. 3. Potent and highly selective bisindolylmaleimides by conformational restriction. J Med Chem36:21-9 (1993) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
cAMP-dependent protein kinase catalytic subunit alpha |
---|
Name: | cAMP-dependent protein kinase catalytic subunit alpha |
Synonyms: | KAPCA_BOVIN | PKA C-alpha | PKC | PRKACA | Protein Kinase C | Protein Kinase C, bovine brain | cAMP-Dependent Protein Kinase (PKA) | cAMP-dependent Protein Kinase, bovine heart | cAMP-dependent protein kinase A | cAMP-dependent protein kinase alpha-catalytic subunit | cAMP-dependent protein kinase, alpha-catalytic subunit |
Type: | Enzyme Complex |
Mol. Mass.: | 40627.77 |
Organism: | Bos taurus (bovine) |
Description: | The PKA holoenzyme purified from bovine heart, exists as an inactive tetrameric complex, which consists of a regulatory dimer associated with two catalytic subunits. It requires cAMP to activate the enzymatic reaction. |
Residue: | 351 |
Sequence: | MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
|
|
|
BDBM2579 |
---|
histone (type Vs) |
---|
Name: | histone (type Vs) |
Synonyms: | n/a |
Type: | Other Protein Type |
Mol. Mass.: | 358.43 |
Organism: | n/a |
Description: | 11 uM [gamma-32P]ATP as co-substrate. |
Residue: | 3 |
Sequence: | |