| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Type-1 angiotensin II receptor B |
|---|
| Ligand | BDBM50010148 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_36482 |
|---|
| IC50 | 5400±n/a nM |
|---|
| Citation |  Bühlmayer, P; Criscione, L; Fuhrer, W; Furet, P; de Gasparo, M; Stutz, S; Whitebread, S Nonpeptidic angiotensin II antagonists: synthesis and in vitro activity of a series of novel naphthalene and tetrahydronaphthalene derivatives. J Med Chem34:3105-14 (1991) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Type-1 angiotensin II receptor B |
|---|
| Name: | Type-1 angiotensin II receptor B |
|---|
| Synonyms: | AGTRB_RAT | AT3 | Agtr1 | Agtr1b | Angiotensin II AT1B | Angiotensin II receptor (AT-1) type-1 | Angiotensin II type 1b (AT-1b) receptor | At1b | Type-1B angiotensin II receptor |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 40929.44 |
|---|
| Organism: | RAT |
|---|
| Description: | Angiotensin II AT1B 0 RAT::P29089 |
|---|
| Residue: | 359 |
|---|
| Sequence: | MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFR
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE
|
|
|
|---|
| BDBM50010148 |
|---|
| n/a |
|---|
| Name | BDBM50010148 |
|---|
| Synonyms: | CHEMBL106934 | {2-Butyl-5-chloro-3-[6-(1H-tetrazol-5-yl)-5,6,7,8-tetrahydro-naphthalen-2-ylmethyl]-3H-imidazol-4-yl}-methanol |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H25ClN6O |
|---|
| Mol. Mass. | 400.905 |
|---|
| SMILES | CCCCc1nc(Cl)c(CO)n1Cc1ccc2CC(CCc2c1)c1nnn[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
