| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50180655 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1729858 (CHEMBL4145136) |
|---|
| EC50 | 1160±n/a nM |
|---|
| Citation |  Hidaka, K; Kimura, T; Sankaranarayanan, R; Wang, J; McDaniel, KF; Kempf, DJ; Kameoka, M; Adachi, M; Kuroki, R; Nguyen, JT; Hayashi, Y; Kiso, Y Identification of Highly Potent Human Immunodeficiency Virus Type-1 Protease Inhibitors against Lopinavir and Darunavir Resistant Viruses from Allophenylnorstatine-Based Peptidomimetics with P2 Tetrahydrofuranylglycine. J Med Chem61:5138-5153 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50180655 |
|---|
| n/a |
|---|
| Name | BDBM50180655 |
|---|
| Synonyms: | A-157378-0 | A-157378.0 | ABT-378 | CHEBI:31781 | Kaletra | Lopinavir | med.21724, Compound 185 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H48N4O5 |
|---|
| Mol. Mass. | 628.8008 |
|---|
| SMILES | CC(C)[C@H](N1CCCNC1=O)C(=O)N[C@H](C[C@H](O)[C@H](Cc1ccccc1)NC(=O)COc1c(C)cccc1C)Cc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
