Reaction Details |
| Report a problem with these data |
Target | Ileal sodium/bile acid cotransporter |
---|
Ligand | BDBM50459099 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1765644 (CHEMBL4200891) |
---|
IC50 | <25119±n/a nM |
---|
Citation | Chen, T; Reich, NW; Bell, N; Finn, PD; Rodriguez, D; Kohler, J; Kozuka, K; He, L; Spencer, AG; Charmot, D; Navre, M; Carreras, CW; Koo-McCoy, S; Tabora, J; Caldwell, JS; Jacobs, JW; Lewis, JG Design of Gut-Restricted Thiazolidine Agonists of G Protein-Coupled Bile Acid Receptor 1 (GPBAR1, TGR5). J Med Chem61:7589-7613 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Ileal sodium/bile acid cotransporter |
---|
Name: | Ileal sodium/bile acid cotransporter |
Synonyms: | ASBT | Apical sodium-dependent bile acid transporter | IBAT | ISBT | Ileal Na(+)/bile acid cotransporter | Ileal sodium-dependent bile acid transporter | NTCP2_MOUSE | Na(+)-dependent ileal bile acid transporter | Ntcp2 | Slc10a2 | Sodium/taurocholate cotransporting polypeptide, ileal | Solute carrier family 10 member 2 |
Type: | PROTEIN |
Mol. Mass.: | 38130.25 |
Organism: | Mus musculus |
Description: | ChEMBL_963356 |
Residue: | 348 |
Sequence: | MDNSSVCPPNATVCEGDSCVVPESNFNAILNTVMSTVLTILLAMVMFSMGCNVEVHKFLG
HIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVVVLIMGCCPGGTGSNILAYWID
GDMDLSVSMTTCSTLLALGMMPLCLFVYTKMWVDSGTIVIPYDSIGISLVALVIPVSFGM
FVNHKWPQKAKIILKIGSITGVILIVLIAVIGGILYQSAWIIEPKLWIIGTIFPIAGYSL
GFFLARLAGQPWYRCRTVALETGMQNTQLCSTIVQLSFSPEDLNLVFTFPLIYTVFQLVF
AAVILGIYVTYRKCYGKNDAEFLEKTDNEMDSRPSFDETNKGFQPDEK
|
|
|
BDBM50459099 |
---|
n/a |
---|
Name | BDBM50459099 |
Synonyms: | CHEMBL4202981 |
Type | Small organic molecule |
Emp. Form. | C36H42Cl2N4O8S |
Mol. Mass. | 761.712 |
SMILES | OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)CNC(=O)c1ccc(COc2cc(Cl)c(CN3CSC[C@H]3C(=O)N3CCN(C4CC4)c4ccccc34)cc2Cl)cc1 |r| |
Structure |
|