| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Phosphoglycerate mutase 1 |
|---|
| Ligand | BDBM50460656 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1770015 |
|---|
| IC50 | 2800±n/a nM |
|---|
| Citation |  Wang, P; Jiang, L; Cao, Y; Zhang, X; Chen, B; Zhang, S; Huang, K; Ye, D; Zhou, L Xanthone derivatives as phosphoglycerate mutase 1 inhibitors: Design, synthesis, and biological evaluation. Bioorg Med Chem26:1961-1970 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Phosphoglycerate mutase 1 |
|---|
| Name: | Phosphoglycerate mutase 1 |
|---|
| Synonyms: | BPG-dependent PGAM 1 | PGAM-B | PGAM1 | PGAM1_HUMAN | PGAMA | Phosphoglycerate mutase 1 | Phosphoglycerate mutase isozyme B |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 28806.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_109479 |
|---|
| Residue: | 254 |
|---|
| Sequence: | MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQ
KRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYD
VPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKR
VLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVR
KAMEAVAAQGKAKK
|
|
|
|---|
| BDBM50460656 |
|---|
| n/a |
|---|
| Name | BDBM50460656 |
|---|
| Synonyms: | CHEMBL4228033 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H13NO7S |
|---|
| Mol. Mass. | 399.374 |
|---|
| SMILES | Oc1cccc2oc3cc(NS(=O)(=O)c4ccccc4)c(O)c(O)c3c(=O)c12 |
|---|
| Structure | 
|
|---|
Search and Browse
