| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase protein |
|---|
| Ligand | BDBM50476891 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_447798 (CHEMBL896807) |
|---|
| IC50 | 17±n/a nM |
|---|
| Citation |  Gagnon, A; Amad, MH; Bonneau, PR; Coulombe, R; DeRoy, PL; Doyon, L; Duan, J; Garneau, M; Guse, I; Jakalian, A; Jolicoeur, E; Landry, S; Malenfant, E; Simoneau, B; Yoakim, C Thiotetrazole alkynylacetanilides as potent and bioavailable non-nucleoside inhibitors of the HIV-1 wild type and K103N/Y181C double mutant reverse transcriptases. Bioorg Med Chem Lett17:4437-41 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase protein |
|---|
| Name: | Reverse transcriptase protein |
|---|
| Synonyms: | Reverse Transcriptase | Reverse Transcriptase (A62V) | Reverse Transcriptase (F61A) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 30203.56 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WJQ2 |
|---|
| Residue: | 259 |
|---|
| Sequence: | PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYEHHPDKWT
VQPIVLPEKDSWTVNDIQK
|
|
|
|---|
| BDBM50476891 |
|---|
| n/a |
|---|
| Name | BDBM50476891 |
|---|
| Synonyms: | CHEMBL233167 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H23Cl2N5O2S |
|---|
| Mol. Mass. | 516.443 |
|---|
| SMILES | CC(C)(CO)C#Cc1ccc(NC(=O)CSc2nnnn2-c2ccc(cc2Cl)C2CC2)c(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
