| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Growth hormone secretagogue receptor type 1 |
|---|
| Ligand | BDBM50477764 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_458616 (CHEMBL941945) |
|---|
| EC50 | 0.199526±n/a nM |
|---|
| Citation |  Heightman, TD; Scott, JS; Longley, M; Bordas, V; Dean, DK; Elliott, R; Hutley, G; Witherington, J; Abberley, L; Passingham, B; Berlanga, M; de Los Frailes, M; Wise, A; Powney, B; Muir, A; McKay, F; Butler, S; Winborn, K; Gardner, C; Darton, J; Campbell, C; Sanger, G Potent achiral agonists of the ghrelin (growth hormone secretagogue) receptor. Part I: Lead identification. Bioorg Med Chem Lett17:6584-7 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Growth hormone secretagogue receptor type 1 |
|---|
| Name: | Growth hormone secretagogue receptor type 1 |
|---|
| Synonyms: | GH-releasing peptide receptor | GHRP | GHS-R | GHSR | GHSR_HUMAN | Ghrelin Receptor (Growth Hormone Secretagogue Receptor Type 1) | Ghrelin receptor | Ghrelin receptor 1a (GHS-R1a) |
|---|
| Type: | Receptor |
|---|
| Mol. Mass.: | 41334.57 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Receptor binding studies use plasma membranes from LLC PK-1 cells transiently transfected with hGHSR1a. |
|---|
| Residue: | 366 |
|---|
| Sequence: | MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
|
|
|
|---|
| BDBM50477764 |
|---|
| n/a |
|---|
| Name | BDBM50477764 |
|---|
| Synonyms: | CHEMBL401134 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H30N4O3S |
|---|
| Mol. Mass. | 478.606 |
|---|
| SMILES | COc1cc2CCN(c2cc1N1C[C@H](C)N[C@H](C)C1)S(=O)(=O)c1ccc(cc1)-c1ccccn1 |
|---|
| Structure | 
|
|---|
Search and Browse
