| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50048866 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1804491 (CHEMBL4303094) |
|---|
| Ki | 2.0±n/a nM |
|---|
| Citation |  Gordon, DE; Jang, GM; Bouhaddou, M; Xu, J; Obernier, K; White, KM; O'Meara, MJ; Rezelj, VV; Guo, JZ; Swaney, DL; Tummino, TA; Hüttenhain, R; Kaake, RM; Richards, AL; Tutuncuoglu, B; Foussard, H; Batra, J; Haas, K; Modak, M; Kim, M; Haas, P; Polacco, BJ; Braberg, H; Fabius, JM; Eckhardt, M; Soucheray, M; Bennett, MJ; Cakir, M; McGregor, MJ; Li, Q; Meyer, B; Roesch, F; Vallet, T; Mac Kain, A; Miorin, L; Moreno, E; Naing, ZZC; Zhou, Y; Peng, S; Shi, Y; Zhang, Z; Shen, W; Kirby, IT; Melnyk, JE; Chorba, JS; Lou, K; Dai, SA; Barrio-Hernandez, I; Memon, D; Hernandez-Armenta, C; Lyu, J; Mathy, CJP; Perica, T; Pilla, KB; Ganesan, SJ; Saltzberg, DJ; Rakesh, R; Liu, X; Rosenthal, SB; Calviello, L; Venkataramanan, S; Liboy-Lugo, J; Lin, Y; Huang, XP; Liu, Y; Wankowicz, SA; Bohn, M; Safari, M; Ugur, FS; Koh, C; Savar, NS; Tran, QD; Shengjuler, D; Fletcher, SJ; O'Neal, MC; Cai, Y; Chang, JCJ; Broadhurst, DJ; Klippsten, S; Sharp, PP; Wenzell, NA; Kuzuoglu-Ozturk, D; Wang, HY; Trenker, R; Young, JM; Cavero, DA; Hiatt, J; Roth, TL; Rathore, U; Subramanian, A; Noack, J; Hubert, M; Stroud, RM; Frankel, AD; Rosenberg, OS; Verba, KA; Agard, DA; Ott, M; Emerman, M; Jura, N; von Zastrow, M; Verdin, E; Ashworth, A; Schwartz, O; d'Enfert, C; Mukherjee, S; Jacobson, M; Malik, HS; Fujimori, DG; Ideker, T; Craik, CS; Floor, SN; Fraser, JS; Gross, JD; Sali, A; Roth, BL; Ruggero, D; Taunton, J; Kortemme, T; Beltrao, P; Vignuzzi, M; García-Sastre, A; Shokat, KM; Shoichet, BK; Krogan, NJ A SARS-CoV-2 protein interaction map reveals targets for drug repurposing. Nature583:459-468 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50048866 |
|---|
| n/a |
|---|
| Name | BDBM50048866 |
|---|
| Synonyms: | 1-Cyclohexyl-4-[3-(5-methoxy-1,2,3,4-tetrahydro-naphthalen-1-yl)-propyl]-piperazine | 1-cyclohexyl-4-(3-(5-methoxy-1,2,3,4-tetrahydronaphthalen-1-yl)propyl)piperazine | 1-cyclohexyl-4-[3-(5-methoxy-1,2,3,4-tetrahydro-naphthalen-1-yl)propyl]piperazine | 1-cyclohexyl-4-[3-(5-methoxy-1,2,3,4-tetrahydronaphthalen-1-yl)propyl]piperazine | CHEMBL53325 | PB-28 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H38N2O |
|---|
| Mol. Mass. | 370.5713 |
|---|
| SMILES | COc1cccc2C(CCCN3CCN(CC3)C3CCCCC3)CCCc12 |
|---|
| Structure | 
|
|---|
Search and Browse
