| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50480929 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_593880 (CHEMBL1037773) |
|---|
| Ki | 0.830000±n/a nM |
|---|
| Citation |  Hidaka, K; Kimura, T; Abdel-Rahman, HM; Nguyen, JT; McDaniel, KF; Kohlbrenner, WE; Molla, A; Adachi, M; Tamada, T; Kuroki, R; Katsuki, N; Tanaka, Y; Matsumoto, H; Wang, J; Hayashi, Y; Kempf, DJ; Kiso, Y Small-sized human immunodeficiency virus type-1 protease inhibitors containing allophenylnorstatine to explore the S2' pocket. J Med Chem52:7604-17 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50480929 |
|---|
| n/a |
|---|
| Name | BDBM50480929 |
|---|
| Synonyms: | CHEMBL573975 | KNI-1689 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H40N4O5S |
|---|
| Mol. Mass. | 568.727 |
|---|
| SMILES | CC(=C)CNC(=O)[C@H]1N(CSC1(C)C)C(=O)[C@@H](O)[C@H](Cc1ccccc1)NC(=O)COc1c(C)cc(N)cc1C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
