Reaction Details |
| Report a problem with these data |
Target | Reverse transcriptase |
---|
Ligand | BDBM50492145 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_968173 (CHEMBL2399276) |
---|
IC50 | 9.4±n/a nM |
---|
Citation | Sturino, CF; Bousquet, Y; James, CA; DeRoy, P; Duplessis, M; Edwards, PJ; Halmos, T; Minville, J; Morency, L; Morin, S; Thavonekham, B; Tremblay, M; Duan, J; Ribadeneira, M; Garneau, M; Pelletier, A; Tremblay, S; Lamorte, L; Bethell, R; Cordingley, MG; Rajotte, D; Simoneau, B Identification of potent and orally bioavailable nucleotide competing reverse transcriptase inhibitors: in vitro and in vivo optimization of a series of benzofurano[3,2-d]pyrimidin-2-one derived inhibitors. Bioorg Med Chem Lett23:3967-75 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Reverse transcriptase |
---|
Name: | Reverse transcriptase |
Synonyms: | n/a |
Type: | Protein |
Mol. Mass.: | 29598.37 |
Organism: | Human immunodeficiency virus 1 |
Description: | Q9WKE8 |
Residue: | 254 |
Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
BDBM50492145 |
---|
n/a |
---|
Name | BDBM50492145 |
Synonyms: | CHEMBL2397570 |
Type | Small organic molecule |
Emp. Form. | C25H26N8O3 |
Mol. Mass. | 486.5257 |
SMILES | CN(C)c1cnc(cn1)-c1nc(=O)n(CCC2CCCO2)c2c3cc(cnc3oc12)-c1cnn(C)c1 |
Structure |
|