| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase |
|---|
| Ligand | BDBM50492178 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_968173 (CHEMBL2399276) |
|---|
| IC50 | 9.9±n/a nM |
|---|
| Citation |  Sturino, CF; Bousquet, Y; James, CA; DeRoy, P; Duplessis, M; Edwards, PJ; Halmos, T; Minville, J; Morency, L; Morin, S; Thavonekham, B; Tremblay, M; Duan, J; Ribadeneira, M; Garneau, M; Pelletier, A; Tremblay, S; Lamorte, L; Bethell, R; Cordingley, MG; Rajotte, D; Simoneau, B Identification of potent and orally bioavailable nucleotide competing reverse transcriptase inhibitors: in vitro and in vivo optimization of a series of benzofurano[3,2-d]pyrimidin-2-one derived inhibitors. Bioorg Med Chem Lett23:3967-75 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase |
|---|
| Name: | Reverse transcriptase |
|---|
| Synonyms: | n/a |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 29598.37 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WKE8 |
|---|
| Residue: | 254 |
|---|
| Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
|---|
| BDBM50492178 |
|---|
| n/a |
|---|
| Name | BDBM50492178 |
|---|
| Synonyms: | CHEMBL2397551 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H20N6O3S |
|---|
| Mol. Mass. | 448.498 |
|---|
| SMILES | Cn1cc(cn1)-c1cnc2oc3c(nc(=O)n(CCC4CCCO4)c3c2c1)-c1cscn1 |
|---|
| Structure | 
|
|---|
Search and Browse
