| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Phospholipase A2, membrane associated |
|---|
| Ligand | BDBM50055364 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_156192 (CHEMBL761443) |
|---|
| IC50 | 527±n/a nM |
|---|
| Citation |  Dillard, RD; Bach, NJ; Draheim, SE; Berry, DR; Carlson, DG; Chirgadze, NY; Clawson, DK; Hartley, LW; Johnson, LM; Jones, ND; McKinney, ER; Mihelich, ED; Olkowski, JL; Schevitz, RW; Smith, AC; Snyder, DW; Sommers, CD; Wery, JP Indole inhibitors of human nonpancreatic secretory phospholipase A2. 2. Indole-3-acetamides with additional functionality. J Med Chem39:5137-58 (1997) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Phospholipase A2, membrane associated |
|---|
| Name: | Phospholipase A2, membrane associated |
|---|
| Synonyms: | GIIC sPLA2 | Group IIA phospholipase A2 | NPS-PLA2 | Non-Pancreatic Secretory Phospholipase A2 | Non-pancreatic secretory phospholipase A2 (hnps-PLA2) | PA2GA_HUMAN | PLA2B | PLA2G2A | PLA2L | Phosphatidylcholine 2-acylhydrolase | Phospholipase A2 group IIA | RASF-A |
|---|
| Type: | Hydrolase |
|---|
| Mol. Mass.: | 16101.20 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | The human nps PLA2 was cloned, and expressed in E. coli. There was a refolding process in the purification. |
|---|
| Residue: | 144 |
|---|
| Sequence: | MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDAT
DRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFAR
NKTTYNKKYQYYSNKHCRGSTPRC
|
|
|
|---|
| BDBM50055364 |
|---|
| n/a |
|---|
| Name | BDBM50055364 |
|---|
| Synonyms: | 3-(1-Benzyl-3-carbamoylmethyl-2-methyl-1H-indol-5-yloxy)-propionic acid | CHEMBL359388 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H22N2O4 |
|---|
| Mol. Mass. | 366.4104 |
|---|
| SMILES | Cc1c(CC(N)=O)c2cc(OCCC(O)=O)ccc2n1Cc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
