Reaction Details |
| Report a problem with these data |
Target | Phospholipase A2, membrane associated |
---|
Ligand | BDBM50055367 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_156189 (CHEMBL761440) |
---|
IC50 | 7±n/a nM |
---|
Citation | Draheim, SE; Bach, NJ; Dillard, RD; Berry, DR; Carlson, DG; Chirgadze, NY; Clawson, DK; Hartley, LW; Johnson, LM; Jones, ND; McKinney, ER; Mihelich, ED; Olkowski, JL; Schevitz, RW; Smith, AC; Snyder, DW; Sommers, CD; Wery, JP Indole inhibitors of human nonpancreatic secretory phospholipase A2. 3. Indole-3-glyoxamides. J Med Chem39:5159-75 (1997) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Phospholipase A2, membrane associated |
---|
Name: | Phospholipase A2, membrane associated |
Synonyms: | GIIC sPLA2 | Group IIA phospholipase A2 | NPS-PLA2 | Non-Pancreatic Secretory Phospholipase A2 | Non-pancreatic secretory phospholipase A2 (hnps-PLA2) | PA2GA_HUMAN | PLA2B | PLA2G2A | PLA2L | Phosphatidylcholine 2-acylhydrolase | Phospholipase A2 group IIA | RASF-A |
Type: | Hydrolase |
Mol. Mass.: | 16101.20 |
Organism: | Homo sapiens (Human) |
Description: | The human nps PLA2 was cloned, and expressed in E. coli. There was a refolding process in the purification. |
Residue: | 144 |
Sequence: | MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDAT
DRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFAR
NKTTYNKKYQYYSNKHCRGSTPRC
|
|
|
BDBM50055367 |
---|
n/a |
---|
Name | BDBM50055367 |
Synonyms: | CHEMBL345986 | [3-Aminooxalyl-1-(3-chloro-benzyl)-2-ethyl-1H-indol-4-yloxy]-acetic acid |
Type | Small organic molecule |
Emp. Form. | C21H19ClN2O5 |
Mol. Mass. | 414.839 |
SMILES | CCc1c(C(=O)C(N)=O)c2c(OCC(O)=O)cccc2n1Cc1cccc(Cl)c1 |
Structure |
|