Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMu-type opioid receptor
LigandBDBM50064521
Substrate/Competitorn/a
Meas. Tech.ChEMBL_145428
Ki 0.039000±n/a nM
Citation Thomas JBMascarella SWRothman RBPartilla JSXu HMcCullough KBDersch CMCantrell BEZimmerman DMCarroll FI Investigation of the N-substituent conformation governing potency and mu receptor subtype-selectivity in (+)-(3R, 4R)-dimethyl-4-(3-hydroxyphenyl)piperidine opioid antagonists. J Med Chem 41:1980-90 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mu-type opioid receptor
Name:Mu-type opioid receptor
Synonyms:M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1
Type:Enzyme Catalytic Domain
Mol. Mass.:11165.58
Organism:GUINEA PIG
Description:P97266
Residue:98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50064521
n/a
NameBDBM50064521
Synonyms:3-[(3R,4R)-3,4-Dimethyl-1-((E)-3-phenyl-allyl)-piperidin-4-yl]-phenol | 3-[3,4-Dimethyl-1-(3-phenyl-allyl)-piperidin-4-yl]-phenol | CHEMBL51838
TypeSmall organic molecule
Emp. Form.C22H27NO
Mol. Mass.321.4559
SMILESC[C@H]1CN(C\C=C\c2ccccc2)CC[C@@]1(C)c1cccc(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: