Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50064515 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_147291 (CHEMBL755878) |
---|
Ki | 0.355000±n/a nM |
---|
Citation | Thomas, JB; Mascarella, SW; Rothman, RB; Partilla, JS; Xu, H; McCullough, KB; Dersch, CM; Cantrell, BE; Zimmerman, DM; Carroll, FI Investigation of the N-substituent conformation governing potency and mu receptor subtype-selectivity in (+)-(3R, 4R)-dimethyl-4-(3-hydroxyphenyl)piperidine opioid antagonists. J Med Chem41:1980-90 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50064515 |
---|
n/a |
---|
Name | BDBM50064515 |
Synonyms: | 3-[(3R,4R)-3,4-Dimethyl-1-((E)-3-o-tolyl-allyl)-piperidin-4-yl]-phenol | 3-[(3R,4R)-3,4-Dimethyl-1-(3-o-tolyl-allyl)-piperidin-4-yl]-phenol | 3-[3,4-Dimethyl-1-(3-o-tolyl-allyl)-piperidin-4-yl]-phenol | CHEMBL52451 | RTI-5989-25 |
Type | Small organic molecule |
Emp. Form. | C23H29NO |
Mol. Mass. | 335.4825 |
SMILES | C[C@H]1CN(C\C=C\c2ccccc2C)CC[C@@]1(C)c1cccc(O)c1 |
Structure |
|