Reaction Details |
| Report a problem with these data |
Target | Neutrophil elastase |
---|
Ligand | BDBM50065161 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_63976 (CHEMBL677602) |
---|
Ki | 40±n/a nM |
---|
Citation | Cregge, RJ; Durham, SL; Farr, RA; Gallion, SL; Hare, CM; Hoffman, RV; Janusz, MJ; Kim, HO; Koehl, JR; Mehdi, S; Metz, WA; Peet, NP; Pelton, JT; Schreuder, HA; Sunder, S; Tardif, C Inhibition of human neutrophil elastase. 4. Design, synthesis, X-ray crystallographic analysis, and structure-activity relationships for a series of P2-modified, orally active peptidyl pentafluoroethyl ketones. J Med Chem41:2461-80 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Neutrophil elastase |
---|
Name: | Neutrophil elastase |
Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
Type: | Enzyme |
Mol. Mass.: | 28532.38 |
Organism: | Homo sapiens (Human) |
Description: | P08246 |
Residue: | 267 |
Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
BDBM50065161 |
---|
n/a |
---|
Name | BDBM50065161 |
Synonyms: | Acetic acid 1-{(S)-3-methyl-2-[4-(morpholine-4-carbonyl)-benzoylamino]-butyryl}-5-(3,3,4,4,4-pentafluoro-1-isopropyl-2-oxo-butylcarbamoyl)-pyrrolidin-3-yl ester | CHEMBL84035 |
Type | Small organic molecule |
Emp. Form. | C31H39F5N4O8 |
Mol. Mass. | 690.6554 |
SMILES | CC(C)[C@H](NC(=O)c1ccc(cc1)C(=O)N1CCOCC1)C(=O)N1CC(CC1C(=O)NC(C(C)C)C(=O)C(F)(F)C(F)(F)F)OC(C)=O |
Structure |
|