Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin K
LigandBDBM50066647
Substrate/Competitorn/a
Meas. Tech.ChEMBL_48326
Ki 0.5±n/a nM
Citation Marquis RWYamashita DSRu YLoCastro SMOh HJErhard KFDesJarlais RLHead MSSmith WWZhao BJanson CAAbdel-Meguid SSTomaszek TALevy MAVeber DF Conformationally constrained 1,3-diamino ketones: a series of potent inhibitors of the cysteine protease cathepsin K. J Med Chem 41:3563-7 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin K
Name:Cathepsin K
Synonyms:CTSK | CTSO | CTSO2 | Cathepsin O | Cathepsin O2 | Cathepsin X
Type:Enzyme
Mol. Mass.:36975.68
Organism:Homo sapiens (Human)
Description:P43235
Residue:329
Sequence:
MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIH
NLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVD
YRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGG
YMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGE
NWGNKGYILMARNKNNACGIANLASFPKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50066647
n/a
NameBDBM50066647
Synonyms:CHEMBL113724 | {(S)-3-Methyl-1-[3-oxo-1-(4-phenoxy-benzenesulfonyl)-piperidin-4-ylcarbamoyl]-butyl}-carbamic acid benzyl ester | {3-Methyl-1-[3-oxo-1-(4-phenoxy-benzenesulfonyl)-piperidin-4-ylcarbamoyl]-butyl}-carbamic acid benzyl ester
TypeSmall organic molecule
Emp. Form.C31H35N3O7S
Mol. Mass.593.69
SMILESCC(C)C[C@H](NC(=O)OCc1ccccc1)C(=O)NC1CCN(CC1=O)S(=O)(=O)c1ccc(Oc2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: