| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50074682 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_159770 (CHEMBL763095) |
|---|
| IC50 | 10000±n/a nM |
|---|
| Citation |  Bouras, A; Boggetto, N; Benatalah, Z; de Rosny, E; Sicsic, S; Reboud-Ravaux, M Design, synthesis, and evaluation of conformationally constrained tongs, new inhibitors of HIV-1 protease dimerization. J Med Chem42:957-62 (1999) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50074682 |
|---|
| n/a |
|---|
| Name | BDBM50074682 |
|---|
| Synonyms: | (S)-2-[(S)-2-((S)-2-{4-[7-(3-{(S)-1-[(S)-1-((S)-1-Carboxy-2-methyl-propylcarbamoyl)-3-methyl-butylcarbamoyl]-2-hydroxy-propylcarbamoyl}-propoxy)-naphthalen-2-yloxy]-butyrylamino}-3-hydroxy-butyrylamino)-4-methyl-pentanoylamino]-3-methyl-butyric acid | CHEMBL172440 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C48H74N6O14 |
|---|
| Mol. Mass. | 959.133 |
|---|
| SMILES | CC(C)C[C@H](NC(=O)[C@@H](NC(=O)CCCOc1ccc2ccc(OCCCC(=O)N[C@@H](C(C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(O)=O)cc2c1)C(C)O)C(=O)N[C@@H](C(C)C)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
