Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 4 |
---|
Ligand | BDBM50532533 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1923254 (CHEMBL4426210) |
---|
EC50 | 0.500000±n/a nM |
---|
Citation | Gilmore, JL; Sheppeck, JE; Watterson, SH; Haque, L; Mukhopadhyay, P; Tebben, AJ; Galella, MA; Shen, DR; Yarde, M; Cvijic, ME; Borowski, V; Gillooly, K; Taylor, T; McIntyre, KW; Warrack, B; Levesque, PC; Li, JP; Cornelius, G; D'Arienzo, C; Marino, A; Balimane, P; Salter-Cid, L; Barrish, JC; Pitts, WJ; Carter, PH; Xie, J; Dyckman, AJ Discovery and Structure-Activity Relationship (SAR) of a Series of Ethanolamine-Based Direct-Acting Agonists of Sphingosine-1-phosphate (S1P1). J Med Chem59:6248-64 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 4 |
---|
Name: | Sphingosine 1-phosphate receptor 4 |
Synonyms: | EDG6 | Endothelial differentiation G-protein coupled receptor 6 | S1P receptor 4 | S1P receptor Edg-6 | S1P4 | S1PR4 | S1PR4_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-6 | Sphingosine-1-phosphate receptor 4 | sphingosine-1-phosphate 4 S1P4 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 41647.39 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 384 |
Sequence: | MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLV
VLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFL
REGLLFTALAASTFSLLFTAGERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLP
LLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRP
AARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS
AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDS
FRGSRSLSFRMREPLSSISSVRSI
|
|
|
BDBM50532533 |
---|
n/a |
---|
Name | BDBM50532533 |
Synonyms: | CHEMBL4458575 |
Type | Small organic molecule |
Emp. Form. | C27H25F3N4O5 |
Mol. Mass. | 542.5064 |
SMILES | O[C@H](CN1CCC[C@H](CC(O)=O)C1)c1ccc(cc1)-c1noc(n1)-c1onc(c1C(F)(F)F)-c1ccccc1 |r| |
Structure |
|