Reaction Details |
| Report a problem with these data |
Target | Serine protease 1 |
---|
Ligand | BDBM50090238 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_213085 |
---|
Ki | 153000±n/a nM |
---|
Citation | Hayler, J; Kane, PD; LeGrand, D; Lugrin, F; Menear, K; Price, R; Allen, M; Cockcroft, X; Ambler, J; Butler, K; Dunnet, K; Mitchelson, A; Talbot, M; Tweed, M; Wills, N The design and synthesis of thrombin inhibitors: the introduction of in vivo efficacy and oral bioavailability into benzthiazolylalanine inhibitors. Bioorg Med Chem Lett10:1567-70 (2000) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine protease 1 |
---|
Name: | Serine protease 1 |
Synonyms: | Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | TRP1 | TRY1 | TRY1_HUMAN | TRYP1 | Thrombin & trypsin | Trypsin | Trypsin I | Trypsin-1 |
Type: | Enzyme |
Mol. Mass.: | 26557.80 |
Organism: | Homo sapiens (Human) |
Description: | P07477 |
Residue: | 247 |
Sequence: | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
|
|
|
BDBM50090238 |
---|
n/a |
---|
Name | BDBM50090238 |
Synonyms: | 3,3-Dimethyl-6-{3-[4-(2-morpholin-4-yl-2-oxo-ethyl)-piperazin-1-yl]-3-oxo-propyl}-1,2,3,4-tetrahydro-quinoline-8-sulfonic acid {(S)-1-benzothiazol-2-ylmethyl-2-[4-(2-fluoro-ethyl)-piperidin-1-yl]-2-oxo-ethyl}-amide | CHEMBL263806 |
Type | Small organic molecule |
Emp. Form. | C41H56FN7O6S2 |
Mol. Mass. | 826.055 |
SMILES | CC1(C)CNc2c(C1)cc(CCC(=O)N1CCN(CC(=O)N3CCOCC3)CC1)cc2S(=O)(=O)N[C@@H](Cc1nc2ccccc2s1)C(=O)N1CCC(CCF)CC1 |
Structure |
|