Reaction Details |
| Report a problem with these data |
Target | Mitogen-activated protein kinase 14 |
---|
Ligand | BDBM50095430 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_124639 |
---|
IC50 | 400±n/a nM |
---|
Citation | Redman, AM; Johnson, JS; Dally, R; Swartz, S; Wild, H; Paulsen, H; Caringal, Y; Gunn, D; Renick, J; Osterhout, M; Kingery-Wood, J; Smith, RA; Lee, W; Dumas, J; Wilhelm, SM; Housley, TJ; Bhargava, A; Ranges, GE; Shrikhande, A; Young, D; Bombara, M; Scott, WJ p38 kinase inhibitors for the treatment of arthritis and osteoporosis: thienyl, furyl, and pyrrolyl ureas. Bioorg Med Chem Lett11:9-12 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mitogen-activated protein kinase 14 |
---|
Name: | Mitogen-activated protein kinase 14 |
Synonyms: | CSAID-binding protein | CSBP | CSBP1 | CSBP2 | CSPB1 | Cytokine suppressive anti-inflammatory drug-binding protein | MAP kinase 14 | MAP kinase MXI2 | MAP kinase p38 alpha | MAPK 14 | MAPK14 | MAX-interacting protein 2 | MK14_HUMAN | MXI2 | Mitogen-activated protein kinase p38 alpha | SAPK2A | Stress-activated protein kinase 2a | p38 MAP kinase alpha/beta |
Type: | Serine/threonine-protein kinase |
Mol. Mass.: | 41286.76 |
Organism: | Homo sapiens (Human) |
Description: | Q16539 |
Residue: | 360 |
Sequence: | MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
|
|
|
BDBM50095430 |
---|
n/a |
---|
Name | BDBM50095430 |
Synonyms: | 5-tert-Butyl-1-methyl-3-(3-p-tolyl-ureido)-1H-pyrrole-2-carboxylic acid methyl ester | CHEMBL18852 | methyl 5-tert-butyl-1-methyl-3-(3-p-tolylureido)-1H-pyrrole-2-carboxylate |
Type | Small organic molecule |
Emp. Form. | C19H25N3O3 |
Mol. Mass. | 343.4201 |
SMILES | COC(=O)c1c(NC(=O)Nc2ccc(C)cc2)cc(n1C)C(C)(C)C |
Structure |
|