| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Growth hormone secretagogue receptor type 1 |
|---|
| Ligand | BDBM50539687 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1978553 (CHEMBL4611688) |
|---|
| IC50 | 1900±n/a nM |
|---|
| Citation |  Davidsson, Ö; Nilsson, K; Brånalt, J; Andersson, T; Berggren, K; Chen, Y; Fjellström, O; Gradén, H; Gustafsson, L; Hermansson, NO; Jansen, F; Johannesson, P; Ohlsson, B; Tyrchan, C; Wellner, A; Wellner, E; Ölwegård-Halvarsson, M Identification of novel GPR81 agonist lead series for target biology evaluation. Bioorg Med Chem Lett30:0 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Growth hormone secretagogue receptor type 1 |
|---|
| Name: | Growth hormone secretagogue receptor type 1 |
|---|
| Synonyms: | GH-releasing peptide receptor | GHRP | GHS-R | GHSR | GHSR_HUMAN | Ghrelin Receptor (Growth Hormone Secretagogue Receptor Type 1) | Ghrelin receptor | Ghrelin receptor 1a (GHS-R1a) |
|---|
| Type: | Receptor |
|---|
| Mol. Mass.: | 41334.57 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Receptor binding studies use plasma membranes from LLC PK-1 cells transiently transfected with hGHSR1a. |
|---|
| Residue: | 366 |
|---|
| Sequence: | MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
|
|
|
|---|
| BDBM50539687 |
|---|
| n/a |
|---|
| Name | BDBM50539687 |
|---|
| Synonyms: | CHEMBL4635089 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H27ClN4O5S |
|---|
| Mol. Mass. | 531.024 |
|---|
| SMILES | CCOc1cc(Cl)c(cc1N1CCOCC1)-c1ccc(-c2nc3CCN(Cc3s2)C(=O)CO)c(=O)[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
