| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptide deformylase |
|---|
| Ligand | BDBM50100108 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_154313 (CHEMBL762798) |
|---|
| IC50 | 290±n/a nM |
|---|
| Citation |  Apfel, C; Banner, DW; Bur, D; Dietz, M; Hubschwerlen, C; Locher, H; Marlin, F; Masciadri, R; Pirson, W; Stalder, H 2-(2-Oxo-1,4-dihydro-2H-quinazolin-3-yl)- and 2-(2,2-dioxo-1,4-dihydro-2H-2lambda6-benzo[1,2,6]thiadiazin-3-yl)-N-hydroxy-acetamides as potent and selective peptide deformylase inhibitors. J Med Chem44:1847-52 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptide deformylase |
|---|
| Name: | Peptide deformylase |
|---|
| Synonyms: | DEF_ECOLI | PDF | Peptide Deformylase | Polypeptide deformylase | def | fms |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 19323.16 |
|---|
| Organism: | Escherichia coli (strain K12) |
|---|
| Description: | The pdf gene from E. coli K12 was cloned and protein was expressed and purified from E. coli BL21(DE3). |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIV
IDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFE
LEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLKARA
|
|
|
|---|
| BDBM50100108 |
|---|
| n/a |
|---|
| Name | BDBM50100108 |
|---|
| Synonyms: | 2-[5-Chloro-2,2-dioxo-1-(3-phenyl-propyl)-1,4-dihydro-2H-2lambda*6*-benzo[1,2,6]thiadiazin-3-yl]-N-hydroxy-acetamide | CHEMBL292202 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H20ClN3O4S |
|---|
| Mol. Mass. | 409.887 |
|---|
| SMILES | ONC(=O)CN1Cc2c(Cl)cccc2N(CCCc2ccccc2)S1(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
