| Reaction Details |
|---|
 | Report a problem with these data |
| Target | C-C chemokine receptor type 5 |
|---|
| Ligand | BDBM50106991 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_39504 (CHEMBL654033) |
|---|
| IC50 | 2±n/a nM |
|---|
| Citation |  Willoughby, CA; Berk, SC; Rosauer, KG; Degrado, S; Chapman, KT; Gould, SL; Springer, MS; Malkowitz, L; Schleif, WA; Hazuda, D; Miller, M; Kessler, J; Danzeisen, R; Holmes, K; Lineberger, J; Carella, A; Carver, G; Emini, EA Combinatorial synthesis of CCR5 antagonists. Bioorg Med Chem Lett11:3137-41 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| C-C chemokine receptor type 5 |
|---|
| Name: | C-C chemokine receptor type 5 |
|---|
| Synonyms: | C-C CKR-5 | C-C chemokine receptor type 5 | CC-CKR-5 | CCR-5 | CCR5 | CCR5/mu opioid receptor complex | CCR5_HUMAN | CD_antigen=CD195 | CHEMR13 | CMKBR5 | HIV-1 fusion coreceptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40540.21 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P51681 |
|---|
| Residue: | 352 |
|---|
| Sequence: | MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
|
|
|
|---|
| BDBM50106991 |
|---|
| n/a |
|---|
| Name | BDBM50106991 |
|---|
| Synonyms: | 5-Pyridin-2-yl-thiophene-2-sulfonic acid methyl-{2-phenyl-4-[4-(3-phenyl-propyl)-piperidin-1-yl]-butyl}-amide | CHEMBL106569 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C34H41N3O2S2 |
|---|
| Mol. Mass. | 587.838 |
|---|
| SMILES | CN(CC(CCN1CCC(CCCc2ccccc2)CC1)c1ccccc1)S(=O)(=O)c1ccc(s1)-c1ccccn1 |
|---|
| Structure | 
|
|---|
Search and Browse
