| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Oxidized purine nucleoside triphosphate hydrolase |
|---|
| Ligand | BDBM50152124 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2020002 (CHEMBL4673815) |
|---|
| EC50 | 10.0±n/a nM |
|---|
| Citation |  Kettle, JG; Alwan, H; Bista, M; Breed, J; Davies, NL; Eckersley, K; Fillery, S; Foote, KM; Goodwin, L; Jones, DR; Käck, H; Lau, A; Nissink, JW; Read, J; Scott, JS; Taylor, B; Walker, G; Wissler, L; Wylot, M Potent and Selective Inhibitors of MTH1 Probe Its Role in Cancer Cell Survival. J Med Chem59:2346-61 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Oxidized purine nucleoside triphosphate hydrolase |
|---|
| Name: | Oxidized purine nucleoside triphosphate hydrolase |
|---|
| Synonyms: | 2-hydroxy-dATP diphosphatase | 3.6.1.- | 3.6.1.56 | 7,8-dihydro-8-oxoguanine triphosphatase | 8-oxo-dGTPase | 8ODP_HUMAN | MTH1 | Methylated purine nucleoside triphosphate hydrolase | MutT homolog 1 protein (MTH1) | NUDT1 | Nucleoside diphosphate-linked moiety X motif 1 | Nudix motif 1 | Oxidized purine nucleoside triphosphate hydrolase [42-197] |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 22514.81 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P36639 |
|---|
| Residue: | 156 |
|---|
| Sequence: | MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLT
VDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDD
SYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
|
|
|
|---|
| BDBM50152124 |
|---|
| n/a |
|---|
| Name | BDBM50152124 |
|---|
| Synonyms: | CHEMBL3782004 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H12Cl2N4 |
|---|
| Mol. Mass. | 295.167 |
|---|
| SMILES | Nc1nc(NC2CC2)cc(n1)-c1cccc(Cl)c1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
