Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E2 receptor EP2 subtype |
---|
Ligand | BDBM50117689 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_158305 |
---|
Ki | 27000±n/a nM |
---|
Citation | Gallant, M; Carrière, MC; Chateauneuf, A; Denis, D; Gareau, Y; Godbout, C; Greig, G; Juteau, H; Lachance, N; Lacombe, P; Lamontagne, S; Metters, KM; Rochette, C; Ruel, R; Slipetz, D; Sawyer, N; Tremblay, N; Labelle, M Structure-activity relationship of biaryl acylsulfonamide analogues on the human EP(3) prostanoid receptor. Bioorg Med Chem Lett12:2583-6 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E2 receptor EP2 subtype |
---|
Name: | Prostaglandin E2 receptor EP2 subtype |
Synonyms: | PE2R2_HUMAN | PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP4 subtype | Prostanoid EP2 Receptor |
Type: | Enzyme |
Mol. Mass.: | 39775.71 |
Organism: | Homo sapiens (Human) |
Description: | P43116 |
Residue: | 358 |
Sequence: | MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
|
|
|
BDBM50117689 |
---|
n/a |
---|
Name | BDBM50117689 |
Synonyms: | CHEMBL87371 | Thiophene-2-sulfonic acid [(E)-3-(3',4'-dichloro-biphenyl-2-yl)-acryloyl]-amide |
Type | Small organic molecule |
Emp. Form. | C19H13Cl2NO3S2 |
Mol. Mass. | 438.347 |
SMILES | Clc1ccc(cc1Cl)-c1ccccc1\C=C\C(=O)NS(=O)(=O)c1cccs1 |
Structure |
|