Reaction Details |
| Report a problem with these data |
Target | Melanocortin receptor 5 |
---|
Ligand | BDBM50119371 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_100392 (CHEMBL708684) |
---|
EC50 | 271±n/a nM |
---|
Citation | Sebhat, IK; Martin, WJ; Ye, Z; Barakat, K; Mosley, RT; Johnston, DB; Bakshi, R; Palucki, B; Weinberg, DH; MacNeil, T; Kalyani, RN; Tang, R; Stearns, RA; Miller, RR; Tamvakopoulos, C; Strack, AM; McGowan, E; Cashen, DE; Drisko, JE; Hom, GJ; Howard, AD; MacIntyre, DE; van der Ploeg, LH; Patchett, AA; Nargund, RP Design and pharmacology of N-[(3R)-1,2,3,4-tetrahydroisoquinolinium- 3-ylcarbonyl]-(1R)-1-(4-chlorobenzyl)- 2-[4-cyclohexyl-4-(1H-1,2,4-triazol- 1-ylmethyl)piperidin-1-yl]-2-oxoethylamine (1), a potent, selective, melanocortin subtype-4 receptor agonist. J Med Chem45:4589-93 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Melanocortin receptor 5 |
---|
Name: | Melanocortin receptor 5 |
Synonyms: | MC-2 | MC5-R | MC5R | MC5R_HUMAN | Melanocortin MC5 | Melanocortin receptor (M4 and M5) | Melanocortin receptor 5 | Melanocortin receptor 5 (MC5R) |
Type: | Enzyme |
Mol. Mass.: | 36612.92 |
Organism: | Homo sapiens (Human) |
Description: | P33032 |
Residue: | 325 |
Sequence: | MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
|
|
|
BDBM50119371 |
---|
n/a |
---|
Name | BDBM50119371 |
Synonyms: | 1,2,3,4-Tetrahydro-isoquinoline-3-carboxylic acid [1-(4-chloro-benzyl)-2-(4-cyclohexyl-4-[1,2,4]triazol-1-ylmethyl-piperidin-1-yl)-2-oxo-ethyl]-amide | CHEMBL334457 |
Type | Small organic molecule |
Emp. Form. | C33H41ClN6O2 |
Mol. Mass. | 589.171 |
SMILES | Clc1ccc(C[C@@H](NC(=O)[C@@H]2Cc3ccccc3CN2)C(=O)N2CCC(Cn3cncn3)(CC2)C2CCCCC2)cc1 |
Structure |
|