Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLDL-associated phospholipase A2
LigandBDBM50125265
Substrate/Competitorn/a
Meas. Tech.ChEMBL_101018
Ki 110±n/a nM
Citation Blackie JABloomer JCBrown MJCheng HYHammond BHickey DMIfe RJLeach CALewis VAMacphee CHMilliner KJMoores KEPinto ILSmith SAStansfield IGStanway SJTaylor MATheobald CJ The identification of clinical candidate SB-480848: a potent inhibitor of lipoprotein-associated phospholipase A2. Bioorg Med Chem Lett 13:1067-70 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
LDL-associated phospholipase A2
Name:LDL-associated phospholipase A2
Synonyms:1-alkyl-2-acetylglycerophosphocholine esterase | 2-acetyl-1-alkylglycerophosphocholine esterase | LDL-PLA(2) | PAF 2-acylhydrolase | PAF acetylhydrolase | Platelet-activating factor acetylhydrolase
Type:PROTEIN
Mol. Mass.:50084.41
Organism:Homo sapiens (Human)
Description:ChEMBL_156212
Residue:441
Sequence:
MVPPKLHVLFCLCGCLAVVYPFDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGN
GPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNI
LRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHR
DRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDID
HGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMF
PLGDEVYSRIPQPLFFINSEYFQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFA
TGKIIGHMLKLKGDIDSNVAIDLSNKASLAFLQKHLGLHKDFDQWDCLIEGDDENLIPGT
NINTTNQHIMLQNSSGIEKYN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50125265
n/a
NameBDBM50125265
Synonyms:CHEMBL204021 | N-(2-Diethylamino-ethyl)-2-[2-(4-fluoro-benzylsulfanyl)-4-oxo-4,5,6,7-tetrahydro-cyclopentapyrimidin-1-yl]-N-(4'-trifluoromethyl-biphenyl-4-ylmethyl)-acetamide
TypeSmall organic molecule
Emp. Form.C36H38F4N4O2S
Mol. Mass.666.771
SMILESCCN(CC)CCN(Cc1ccc(cc1)-c1ccc(cc1)C(F)(F)F)C(=O)Cn1c2CCCc2c(=O)nc1SCc1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: