| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Ligand | BDBM50132560 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_66292 |
|---|
| IC50 | 26±n/a nM |
|---|
| Citation |  Yang, W; Keenan, TP; Rozamus, LW; Wang, X; Rivera, VM; Rollins, CT; Clackson, T; Holt, DA Regulation of gene expression by synthetic dimerizers with novel specificity. Bioorg Med Chem Lett13:3181-4 (2003) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Synonyms: | 12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKB1A_HUMAN | FKBP-12 | FKBP-1A | FKBP1 | FKBP12 | FKBP1A | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase | RyR1/FKBP12 | mTOR/FKBP12A/FKBP12B |
|---|
| Type: | Isomerase |
|---|
| Mol. Mass.: | 11953.09 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P62942 |
|---|
| Residue: | 108 |
|---|
| Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
|
|
|
|---|
| BDBM50132560 |
|---|
| n/a |
|---|
| Name | BDBM50132560 |
|---|
| Synonyms: | (S)-1-((S)-2-Benzo[1,3]dioxol-5-yl-butyryl)-piperidine-2-carboxylic acid (R)-1-(3-carboxymethoxy-phenyl)-3-(3,4-dimethoxy-phenyl)-propyl ester | CHEMBL324646 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C36H41NO10 |
|---|
| Mol. Mass. | 647.7114 |
|---|
| SMILES | CC[C@H](C(=O)N1CCCC[C@H]1C(=O)O[C@H](CCc1ccc(OC)c(OC)c1)c1cccc(OCC(O)=O)c1)c1ccc2OCOc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
