Reaction Details |
| Report a problem with these data |
Target | Kallikrein-1 |
---|
Ligand | BDBM50140416 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_92384 |
---|
IC50 | >10000±n/a nM |
---|
Citation | Jia, ZJ; Wu, Y; Huang, W; Zhang, P; Song, Y; Woolfrey, J; Sinha, U; Arfsten, AE; Edwards, ST; Hutchaleelaha, A; Hollennbach, SJ; Lambing, JL; Scarborough, RM; Zhu, BY 1-(2-Naphthyl)-1H-pyrazole-5-carboxylamides as potent factor Xa inhibitors. Part 3: Design, synthesis and SAR of orally bioavailable benzamidine-P4 inhibitors. Bioorg Med Chem Lett14:1229-34 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Kallikrein-1 |
---|
Name: | Kallikrein-1 |
Synonyms: | KLK1 | KLK1_HUMAN | Kallikrein 1 | Kallikrein-1 | Kidney/pancreas/salivary gland kallikrein | Tissue kallikrein |
Type: | Enzyme |
Mol. Mass.: | 28874.69 |
Organism: | Homo sapiens (Human) |
Description: | P06870 |
Residue: | 262 |
Sequence: | MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWV
LTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHD
LMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKIL
PNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNK
PSVAVRVLSYVKWIEDTIAENS
|
|
|
BDBM50140416 |
---|
n/a |
---|
Name | BDBM50140416 |
Synonyms: | 2-(3-Fluoro-naphthalen-2-yl)-5-methyl-2H-pyrazole-3-carboxylic acid [2-fluoro-4-(1-methyl-4,5-dihydro-1H-imidazol-2-yl)-phenyl]-amide | CHEMBL21052 |
Type | Small organic molecule |
Emp. Form. | C25H21F2N5O |
Mol. Mass. | 445.4639 |
SMILES | CN1CCN=C1c1ccc(NC(=O)c2cc(C)nn2-c2cc3ccccc3cc2F)c(F)c1 |c:4| |
Structure |
|