Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 2 |
---|
Ligand | BDBM50148436 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_201452 (CHEMBL807597) |
---|
IC50 | 1.4±n/a nM |
---|
Citation | Hale, JJ; Doherty, G; Toth, L; Mills, SG; Hajdu, R; Keohane, CA; Rosenbach, M; Milligan, J; Shei, GJ; Chrebet, G; Bergstrom, J; Card, D; Forrest, M; Sun, SY; West, S; Xie, H; Nomura, N; Rosen, H; Mandala, S Selecting against S1P3 enhances the acute cardiovascular tolerability of 3-(N-benzyl)aminopropylphosphonic acid S1P receptor agonists. Bioorg Med Chem Lett14:3501-5 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 2 |
---|
Name: | Sphingosine 1-phosphate receptor 2 |
Synonyms: | EDG5 | S1P2 | S1PR2 | S1PR2_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-5 | Sphingosine-1-phosphate receptor 2 | ndothelial differentiation G-protein coupled receptor 5 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 38883.16 |
Organism: | Homo sapiens (Human) |
Description: | Membranes isolated from S1P2-transfected CHO cells were used in ligand binding assay. |
Residue: | 353 |
Sequence: | MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV
FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS
TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG
VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
|
|
|
BDBM50148436 |
---|
n/a |
---|
Name | BDBM50148436 |
Synonyms: | CHEMBL119382 | {3-[4-(2-Heptyl-2H-tetrazol-5-yl)-benzylamino]-propyl}-phosphonic acid |
Type | Small organic molecule |
Emp. Form. | C18H30N5O3P |
Mol. Mass. | 395.4363 |
SMILES | CCCCCCCn1nnc(n1)-c1ccc(CNCCCP(O)(O)=O)cc1 |
Structure |
|