| Reaction Details |
|---|
 | Report a problem with these data |
| Target | G-protein coupled receptor 6 |
|---|
| Ligand | BDBM50582428 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2154533 (CHEMBL5039193) |
|---|
| EC50 | 29000±n/a nM |
|---|
| Citation |  Sun, H; Monenschein, H; Schiffer, HH; Reichard, HA; Kikuchi, S; Hopkins, M; Macklin, TK; Hitchcock, S; Adams, M; Green, J; Brown, J; Murphy, ST; Kaushal, N; Collia, DR; Moore, S; Ray, WJ; English, NM; Carlton, MBL; Brice, NL First-Time Disclosure of CVN424, a Potent and Selective GPR6 Inverse Agonist for the Treatment of Parkinson's Disease: Discovery, Pharmacological Validation, and Identification of a Clinical Candidate. J Med Chem64:9875-9890 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| G-protein coupled receptor 6 |
|---|
| Name: | G-protein coupled receptor 6 |
|---|
| Synonyms: | G-protein coupled receptor 6 (GPR6) | GPR6 | GPR6_HUMAN | Sphingosine 1-phosphate receptor GPR6 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 37886.39 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P46095 |
|---|
| Residue: | 362 |
|---|
| Sequence: | MNASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGANGSLELSSQL
SAGPPGLLLPAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLL
AGCGLILHFVFQYLVPSETVSLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRR
TLLGVHLLLAATWTVSLGLGLLPVLGWNCLAERAACSVVRPLARSHVALLSAAFFMVFGI
MLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCV
VGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPS
EV
|
|
|
|---|
| BDBM50582428 |
|---|
| n/a |
|---|
| Name | BDBM50582428 |
|---|
| Synonyms: | CHEMBL3719416 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H22ClFN6 |
|---|
| Mol. Mass. | 412.891 |
|---|
| SMILES | Fc1ccc(Cl)cc1CN1CCN(CC1)c1nc2cnccc2nc1NC1CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
