| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Integrase |
|---|
| Ligand | BDBM50154439 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_304962 (CHEMBL827840) |
|---|
| IC50 | >50000±n/a nM |
|---|
| Citation |  Summa, V; Petrocchi, A; Matassa, VG; Taliani, M; Laufer, R; De Francesco, R; Altamura, S; Pace, P HCV NS5b RNA-dependent RNA polymerase inhibitors: from alpha,gamma-diketoacids to 4,5-dihydroxypyrimidine- or 3-methyl-5-hydroxypyrimidinonecarboxylic acids. Design and synthesis. J Med Chem47:5336-9 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Integrase |
|---|
| Name: | Integrase |
|---|
| Synonyms: | Human immunodeficiency virus type 1 integrase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32231.48 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_90865 |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM50154439 |
|---|
| n/a |
|---|
| Name | BDBM50154439 |
|---|
| Synonyms: | 5,6-Dihydroxy-2-(3-hydroxy-phenyl)-pyrimidine-4-carboxylic acid | CHEMBL364321 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H8N2O5 |
|---|
| Mol. Mass. | 248.1916 |
|---|
| SMILES | OC(=O)c1nc([nH]c(=O)c1O)-c1cccc(O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
