Reaction Details |
| Report a problem with these data |
Target | Histamine H2 receptor |
---|
Ligand | BDBM50156857 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_429753 (CHEMBL914453) |
---|
IC50 | 260±n/a nM |
---|
Citation | Fonquerna, S; Miralpeix, M; Pagès, L; Puig, C; Cardús, A; Antón, F; Cárdenas, A; Vilella, D; Aparici, M; Calaf, E; Prieto, J; Gras, J; Huerta, JM; Warrellow, G; Beleta, J; Ryder, H Synthesis and structure-activity relationships of novel histamine H1 antagonists: indolylpiperidinyl benzoic acid derivatives. J Med Chem47:6326-37 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Histamine H2 receptor |
---|
Name: | Histamine H2 receptor |
Synonyms: | Gastric receptor I | H2R | HISTAMINE H2 | HRH2 | HRH2_HUMAN | Histamine H2 receptor | Histamine H2-Gs alpha S |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40115.31 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 359 |
Sequence: | MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL
AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM
GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ
QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
|
|
|
BDBM50156857 |
---|
n/a |
---|
Name | BDBM50156857 |
Synonyms: | 2-(2-(4-(1-(2-ethoxyethyl)-6-fluoro-1H-indol-3-yl)piperidin-1-yl)ethoxy)benzoic acid | CHEMBL221413 |
Type | Small organic molecule |
Emp. Form. | C26H31FN2O4 |
Mol. Mass. | 454.5337 |
SMILES | CCOCCn1cc(C2CCN(CCOc3ccccc3C(O)=O)CC2)c2ccc(F)cc12 |
Structure |
|