Reaction Details |
| Report a problem with these data |
Target | Prostaglandin D2 receptor 2 |
---|
Ligand | BDBM50162911 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_308687 (CHEMBL834127) |
---|
Ki | 4200±n/a nM |
---|
Citation | Robarge, MJ; Bom, DC; Tumey, LN; Varga, N; Gleason, E; Silver, D; Song, J; Murphy, SM; Ekema, G; Doucette, C; Hanniford, D; Palmer, M; Pawlowski, G; Danzig, J; Loftus, M; Hunady, K; Sherf, BA; Mays, RW; Stricker-Krongrad, A; Brunden, KR; Harrington, JJ; Bennani, YL Isosteric ramatroban analogs: selective and potent CRTH-2 antagonists. Bioorg Med Chem Lett15:1749-53 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin D2 receptor 2 |
---|
Name: | Prostaglandin D2 receptor 2 |
Synonyms: | CD_antigen=CD294 | CRTH2 | Chemoattractant Receptor-homologous molecule expressed on T-helper type 2 cells (CRTH2) | Chemoattractant receptor-homologous molecule expressed on Th2 cells | Chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) | DL1R | G protein-coupled receptor 44 | G-protein coupled receptor 44 | GPR44 | PD2R2_HUMAN | PTGDR2 | Prostaglandin D2 | Prostaglandin D2 receptor 2 | Prostaglandin D2 receptor 2 (PGD2) |
Type: | Enzyme |
Mol. Mass.: | 43295.45 |
Organism: | Homo sapiens (Human) |
Description: | Q9Y5Y4 |
Residue: | 395 |
Sequence: | MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
|
|
|
BDBM50162911 |
---|
n/a |
---|
Name | BDBM50162911 |
Synonyms: | 3-[6-(3,4-Difluoro-benzenesulfonylamino)-1,2,3,4-tetrahydro-carbazol-9-yl]-propionic acid | CHEMBL180258 |
Type | Small organic molecule |
Emp. Form. | C21H20F2N2O4S |
Mol. Mass. | 434.456 |
SMILES | OC(=O)CCn1c2CCCCc2c2cc(NS(=O)(=O)c3ccc(F)c(F)c3)ccc12 |
Structure |
|