Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosomal protein S6 kinase (P70S6K)
LigandBDBM14032
Substrate/Competitorn/a
Meas. Tech.ChEMBL_304643
IC50 70±n/a nM
Citation Bamford MJBailey NDavies SDean DKFrancis LPanchal TAParr CASehmi SSteadman JGTakle AKTownsend JTWilson DM (1H-imidazo[4,5-c]pyridin-2-yl)-1,2,5-oxadiazol-3-ylamine derivatives: further optimisation as highly potent and selective MSK-1-inhibitors. Bioorg Med Chem Lett 15:3407-11 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ribosomal protein S6 kinase (P70S6K)
Name:Ribosomal protein S6 kinase (P70S6K)
Synonyms:70 kDa ribosomal protein S6 kinase 1 | 70 kDa ribosomal protein S6 kinase 1 (P70s6k) | 70 kDa ribosomal protein kinase (p70S6K) | Protein kinase 70S6K (T412E) | Ribosomal protein S6 kinase I | S6K1 | p70 S6 ribosomal protein kinase 1 | p70S6K1
Type:Enzyme
Mol. Mass.:59139.89
Organism:Homo sapiens (Human)
Description:His-tagged S6K1.
Residue:525
Sequence:
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14032
n/a
NameBDBM14032
Synonyms:4-(1-ethyl-1H-imidazo[4,5-c]pyridin-2-yl)-1,2,5-oxadiazol-3-amine | 4-{1-ethyl-1H-imidazo[4,5-c]pyridin-2-yl}-1,2,5-oxadiazol-3-amine | Aminofurazanyl-azabenzimidazole 1 | CHEMBL189657
TypeSmall organic molecule
Emp. Form.C10H10N6O
Mol. Mass.230.226
SMILESCCn1c(nc2cnccc12)-c1nonc1N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: