| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Integrase |
|---|
| Ligand | BDBM50184349 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_338114 (CHEMBL868323) |
|---|
| IC50 | 16±n/a nM |
|---|
| Citation |  Di Santo, R; Costi, R; Roux, A; Artico, M; Lavecchia, A; Marinelli, L; Novellino, E; Palmisano, L; Andreotti, M; Amici, R; Galluzzo, CM; Nencioni, L; Palamara, AT; Pommier, Y; Marchand, C Novel bifunctional quinolonyl diketo acid derivatives as HIV-1 integrase inhibitors: design, synthesis, biological activities, and mechanism of action. J Med Chem49:1939-45 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Integrase |
|---|
| Name: | Integrase |
|---|
| Synonyms: | Human immunodeficiency virus type 1 integrase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32231.48 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_90865 |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM50184349 |
|---|
| n/a |
|---|
| Name | BDBM50184349 |
|---|
| Synonyms: | (Z)-4-[6-((Z)-3-carboxy-3-hydroxy-acryloyl)-1-(4-fluoro-benzyl)-4-oxo-1,4-dihydro-quinolin-3-yl]-2-hydroxy-4-oxo-but-2-enoic acid | CHEMBL377501 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H16FNO9 |
|---|
| Mol. Mass. | 481.3835 |
|---|
| SMILES | OC(=O)C(=O)CC(=O)c1ccc2n(Cc3ccc(F)cc3)cc(C(=O)CC(=O)C(O)=O)c(=O)c2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
