Reaction Details |
| Report a problem with these data |
Target | S-ribosylhomocysteine lyase |
---|
Ligand | BDBM50142500 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_353578 (CHEMBL861693) |
---|
Ki | 61000±n/a nM |
---|
Citation | Shen, G; Rajan, R; Zhu, J; Bell, CE; Pei, D Design and synthesis of substrate and intermediate analogue inhibitors of S-ribosylhomocysteinase. J Med Chem49:3003-11 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
S-ribosylhomocysteine lyase |
---|
Name: | S-ribosylhomocysteine lyase |
Synonyms: | LUXS_BACSU | luxS | ytjB |
Type: | PROTEIN |
Mol. Mass.: | 17709.00 |
Organism: | Bacillus subtilis |
Description: | ChEMBL_764478 |
Residue: | 157 |
Sequence: | MPSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLL
AFTIRSHAEKYDHFDIIDISPMGCQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPA
ANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
|
|
|
BDBM50142500 |
---|
n/a |
---|
Name | BDBM50142500 |
Synonyms: | (2S)-2-amino-4-(methylsulfanyl)butanoic acid | (S)-2-amino-4-(methylthio)butanoic acid | (S)-2-amino-4-(methylthio)butyric acid | (S)-methionine | CHEMBL42336 | L-(-)-methionine | L-Methionin | L-alpha-amino-gamma-methylmercaptobutyric acid | L-methionine | US11021454, Compound L-met |
Type | Small organic molecule |
Emp. Form. | C5H11NO2S |
Mol. Mass. | 149.211 |
SMILES | CSCC[C@H](N)C(O)=O |r| |
Structure |
|