| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50188167 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_379863 (CHEMBL864851) |
|---|
| IC50 | 6±n/a nM |
|---|
| Citation |  Nefzi, A; Ostresh, JM; Appel, JR; Bidlack, J; Dooley, CT; Houghten, RA Identification of potent and highly selective chiral tri-amine and tetra-amine mu opioid receptors ligands: an example of lead optimization using mixture-based libraries. Bioorg Med Chem Lett16:4331-8 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50188167 |
|---|
| n/a |
|---|
| Name | BDBM50188167 |
|---|
| Synonyms: | 4-[(2S)-2-amino-3-{[(2S)-1-{[(2S)-1-[(2S)-2-(aminomethyl)pyrrolidin-1-yl]-3-phenylpropan-2-yl]amino}-3-(4-hydroxyphenyl)propan-2-yl]amino}propyl]phenol | CHEMBL213069 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H45N5O2 |
|---|
| Mol. Mass. | 531.732 |
|---|
| SMILES | NC[C@@H]1CCCN1C[C@H](Cc1ccccc1)NC[C@H](Cc1ccc(O)cc1)NC[C@@H](N)Cc1ccc(O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
