| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Ligand | BDBM50188779 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_389280 (CHEMBL868036) |
|---|
| IC50 | 4800±n/a nM |
|---|
| Citation |  Amarasinghe, KK; Evdokimov, AG; Evidokimov, AG; Xu, K; Clark, CM; Maier, MB; Srivastava, A; Colson, AO; Gerwe, GS; Stake, GE; Howard, BW; Pokross, ME; Gray, JL; Peters, KG Design and synthesis of potent, non-peptidic inhibitors of HPTPbeta. Bioorg Med Chem Lett16:4252-6 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Name: | Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Synonyms: | 3.1.3.2 | 3.1.3.48 | ACP1 | Adipocyte acid phosphatase | LMW-PTP | LMW-PTPase | LMWPTP | Low molecular weight cytosolic acid phosphatase | PPAC_HUMAN | Red cell acid phosphatase 1 | low molecular weight phosphotyrosine protein phosphatase isoform c |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 18042.81 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P24666 |
|---|
| Residue: | 158 |
|---|
| Sequence: | MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
|
|
|
|---|
| BDBM50188779 |
|---|
| n/a |
|---|
| Name | BDBM50188779 |
|---|
| Synonyms: | CHEMBL378423 | ammonium N-{4-[4-ethoxy-2,2-bis(methoxycarbonyl)-4-oxobutyl]phenyl}sulfamate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H20NO9S |
|---|
| Mol. Mass. | 402.397 |
|---|
| SMILES | CCOC(=O)CC(Cc1ccc(NS([O-])(=O)=O)cc1)(C(=O)OC)C(=O)OC |
|---|
| Structure | 
|
|---|
Search and Browse
