Reaction Details |
| Report a problem with these data |
Target | D(4) dopamine receptor |
---|
Ligand | BDBM55121 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_422463 (CHEMBL911046) |
---|
EC50 | 2.2±n/a nM |
---|
Citation | Patel, MV; Kolasa, T; Mortell, K; Matulenko, MA; Hakeem, AA; Rohde, JJ; Nelson, SL; Cowart, MD; Nakane, M; Miller, LN; Uchic, ME; Terranova, MA; El-Kouhen, OF; Donnelly-Roberts, DL; Namovic, MT; Hollingsworth, PR; Chang, R; Martino, BR; Wetter, JM; Marsh, KC; Martin, R; Darbyshire, JF; Gintant, G; Hsieh, GC; Moreland, RB; Sullivan, JP; Brioni, JD; Stewart, AO Discovery of 3-methyl-N-(1-oxy-3',4',5',6'-tetrahydro-2'H-[2,4'-bipyridine]-1'-ylmethyl)benzamide (ABT-670), an orally bioavailable dopamine D4 agonist for the treatment of erectile dysfunction. J Med Chem49:7450-65 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
D(4) dopamine receptor |
---|
Name: | D(4) dopamine receptor |
Synonyms: | D(2C) dopamine receptor | DOPAMINE D4 | DOPAMINE D4.2 | DOPAMINE D4.4 | DRD4 | DRD4_HUMAN | Dopamine D4 receptor |
Type: | Enzyme |
Mol. Mass.: | 48373.19 |
Organism: | Homo sapiens (Human) |
Description: | P21917 |
Residue: | 419 |
Sequence: | MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA
TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT
ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR
DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG
PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPSLPQDPCGPDCAPPAPG
LPPDPCGSNCAPPDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWT
PFFVVHITQALCPACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC
|
|
|
BDBM55121 |
---|
n/a |
---|
Name | BDBM55121 |
Synonyms: | 3-HYDROXYTYRAMINE HYDROCHLORIDE | 4-(2-aminoethyl)benzene-1,2-diol;hydrochloride | 4-(2-aminoethyl)pyrocatechol;hydrochloride | 4-(2-azanylethyl)benzene-1,2-diol;hydrochloride | Dopamine | MLS000069419 | SMR000059081 | cid_65340 |
Type | Small organic molecule |
Emp. Form. | C8H11NO2 |
Mol. Mass. | 153.1784 |
SMILES | NCCc1ccc(O)c(O)c1 |
Structure |
|